If you have been reading about Nicotinamide mononucleotide and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Updated 2025-10-29. Numbers and descriptions here follow the published literature rather than marketing material.
Stability studies indicate that NMN is sensitive to heat, light, and pH extremes. In aqueous solution, hydrolysis can cleave the phosphate linkage or convert NMN to related nicotinamide derivatives, with degradation accelerating at elevated temperatures and alkaline conditions. Solid material is generally more stable when kept dry and cold, and research-grade supplies are often stored at minus twenty degrees Celsius or lower, protected from light and moisture. Repeated freeze-thaw cycles of solutions can promote degradation, so aliquoting is a common laboratory practice. The exact shelf life depends on purity, counterion, packaging, and storage history.
Quality control for NMN focuses on identity, purity, and the absence of harmful contaminants. Certificates of analysis may report high-performance liquid chromatography purity, mass spectrometry identity, residual solvents, heavy metals, and microbial limits, depending on grade and intended use. Because NMN can exist as different isomers, salts, or hydrates, specification sheets should state the exact form being tested. There is no single globally harmonized purity standard for NMN products. Open questions include which degradation products are most relevant under real-world storage and how analytical results from different laboratories can be compared reliably.
Analytical measurement of NMN typically uses reversed-phase high-performance liquid chromatography with ultraviolet detection near 260 nm. Mass spectrometry, often coupled to liquid chromatography, provides sensitive quantification and confirmatory identification in biological matrices. Nuclear magnetic resonance spectroscopy is used to verify molecular structure and distinguish related nucleotides. Because NMN is polar and poorly retained on conventional reversed-phase columns, ion-pairing reagents or hydrophilic interaction chromatography are sometimes employed. Reported purity values depend on the chosen method, calibration standard, and whether related substances are resolved.
Nicotinamide mononucleotide, usually shortened to NMN, is a naturally occurring nucleotide. Its structure consists of a nicotinamide base linked to a ribose sugar that carries a phosphate group. In cells, NMN serves as an intermediate in the salvage pathway that produces nicotinamide adenine dinucleotide, or NAD+. Because NAD+ participates in many oxidation-reduction reactions, NMN sits near central metabolic processes. The compound is not a drug in most jurisdictions and is discussed mainly in biochemistry and nutrition research.
The term NMN commonly refers to the beta isomer, in which the nicotinamide group is attached to the ribose through a beta-glycosidic bond. Commercial material may be supplied as the free acid or as a salt, such as a sodium salt, which affects molecular weight and water solubility. Related compounds include nicotinamide riboside and NAD+ itself, but these are distinct molecules with different formulas and cellular handling. Laboratory research often uses the beta form because it matches the naturally occurring configuration found in biological systems.
| Property | Value | Notes |
|---|---|---|
| Typical purity assay | HPLC-UV or LC-MS | Purity may be reported as area percent or weight percent. |
| Identification methods | NMR, high-resolution MS, UV spectroscopy | Used together for structural confirmation. |
| Storage temperature | -20 °C or below, desiccated | Limits hydrolysis and microbial growth. |
| Light sensitivity | Protect from light | Amber glass or opaque containers reduce photodegradation. |
| Common synonyms | Nicotinamide mononucleotide, beta-NMN, NMN | Synonym use varies by isomer and salt form. |
Analytical identification of NMN commonly uses high-performance liquid chromatography with ultraviolet detection, liquid chromatography-mass spectrometry, and nuclear magnetic resonance spectroscopy; HPLC can estimate purity by peak area, while mass spectrometry confirms molecular mass and fragmentation. NMR provides structural confirmation. Because NMN is charged, ion-pairing reagents or hydrophilic interaction liquid chromatography columns can improve retention and peak shape. In biological samples, LC-MS/MS with stable isotope internal standards is often used to quantify NMN and related NAD+ metabolites. Method validation is important because matrix effects and rapid enzymatic interconversion can complicate measurements.
Quality control for NMN typically checks identity, assay purity, residual solvents, heavy metals, and microbial limits, depending on the intended use and market. A certificate of analysis may report appearance, solubility, water content, and storage recommendations. Independent verification can compare chromatographic retention time and mass spectrum against a certified reference standard. Regulatory expectations differ between research chemicals, dietary ingredients, and pharmaceutical products. Impurity profiles and stability data are often requested for product approval, and open questions remain about how best to standardize NMN measurements across laboratories.
NMN is a polar, water-soluble nucleotide. In solid form it is usually a white to off-white powder. The compound is sensitive to heat, light, moisture, and extremes of pH, and aqueous solutions tend to degrade faster than dry material. Recommended storage for research samples is typically -20 °C or below in a sealed, desiccated container protected from light. Repeated freeze-thaw cycles should be avoided, and these handling practices help maintain identity and purity during laboratory use.
Nicotinamide mononucleotide, commonly abbreviated NMN, is a naturally occurring nucleotide. Its structure combines a nicotinamide ring with a ribose sugar and a phosphate group. The compound appears in cells across many organisms as an intermediate in the production of nicotinamide adenine dinucleotide, or NAD+. Because NMN sits close to NAD+ in metabolism, it has drawn interest in biochemistry and aging research. The molecule is not a dietary essential nutrient in the classical sense, and its presence in food is generally low and variable.
NAD+ serves as a coenzyme in redox reactions and as a substrate for enzymes involved in DNA repair and cellular signaling. In the salvage pathway, nicotinamide is converted to NMN by the enzyme NAMPT. NMN is then converted to NAD+ by NMNAT enzymes. A separate route links nicotinamide riboside to NMN through phosphorylation. These pathways maintain NAD+ levels, which can decline with age or metabolic stress in some tissues. The relative contribution of circulating NMN to tissue NAD+ remains an active area of study.
Research on NMN includes cell studies, animal experiments, and a growing number of human trials. Many early findings come from mice, where changes in NAD+ levels and metabolic markers have been reported. Human data are more limited, and questions remain about effective routes of administration, tissue distribution, and long-term effects. Some trials measure NAD+ in blood or tissue, while others assess physical function or metabolic outcomes. Regulatory status differs between countries, and NMN is not universally approved as a dietary supplement or therapeutic agent.
Stability testing examines how temperature, humidity, light, and pH affect NMN over time. The compound is generally stored cold, often at minus twenty degrees Celsius or lower, in a desiccated container protected from light. Aqueous solutions tend to be less stable than dry powder because hydrolysis and dephosphorylation can occur, potentially forming nicotinamide riboside or other degradation products. Stress studies may expose samples to heat, acid, base, oxidation, and strong light to identify likely degradation pathways. Results from such studies help define shelf life and handling recommendations, though exact stability depends on formulation and packaging.
Quality control for NMN materials typically includes identity, assay, purity, and impurity profiling. Tests may cover residual solvents, heavy metals, microbial limits, and water content, depending on the intended use and local rules. Impurity profiles can include related substances such as nicotinamide, nicotinamide riboside, and NAD+, which may form during synthesis or storage. Because commercial NMN can be offered as different salts or hydrate forms, a certificate of analysis should state the form and the analytical methods used. Independent verification is relevant because supplement markets vary in testing requirements and enforcement.
Laboratory identification of NMN usually relies on chromatographic separation coupled with ultraviolet or mass spectrometric detection. High-performance liquid chromatography with UV absorbance can quantify the compound against a reference standard, while liquid chromatography-tandem mass spectrometry offers lower detection limits and better specificity in complex matrices. Nuclear magnetic resonance spectroscopy can confirm structural identity and isomeric form. Ion chromatography or capillary electrophoresis may be used to identify counterions such as sodium. Method validation includes accuracy, precision, linearity, and limits of detection.
Chemically, NMN is described by the molecular formula C11H15N2O8P and a molecular mass near 334.22 g/mol. The beta anomer has a CAS Registry Number of 1094-61-7. It is typically supplied as a white to off-white powder for laboratory use. The molecule carries a phosphate group and a positively charged nicotinamide ring, giving it polar and water-soluble character. These properties influence how it is detected, purified, and stored in research and analytical laboratories.
Nicotinamide mononucleotide, abbreviated NMN, is a nucleotide composed of nicotinamide, ribose, and phosphate. Its structure links nicotinamide to D-ribose 5-phosphate through a glycosidic bond, placing it in the pyridine nucleotide family. The compound exists in alpha and beta anomeric forms, and the beta form is the one used in NAD+ biosynthesis. NMN is not a protein or a hormone; it is a small water-soluble molecule that occurs in living cells as a metabolic intermediate.
Natural sources of NMN include mammals, plants, and microorganisms, where it functions as an intermediate in NAD+ salvage and biosynthesis pathways. In mammals, the enzyme nicotinamide phosphoribosyltransferase produces NMN from nicotinamide and phosphoribosyl pyrophosphate. NMN is then converted to NAD+ by nicotinamide mononucleotide adenylyltransferase. Some foods contain measurable NMN, but reported amounts vary widely by species, tissue, and analytical method. The extent to which dietary NMN contributes to cellular NAD+ pools remains an open research question.
=== Mechanisms of drug-induced cholestasis === Drugs may induce cholestasis by interfering with 1) hepatic transporters, 2) bile canaliculi dynamics, and/or 3) cell structure and protein localization. Hepatic transporters are essential for maintaining enterohepatic bile flow and bile acid homeostasis. Therefore, their direct inhibition by certain drugs may lead to cholestasis. Relevant transporters implicated include BSEP, MDR3, MRP2-4, and NTCP. Cholestasis can result from competitive inhibition of BSEP by several drugs, including cyclosporine A, rifampicin, nefazodone, glibenclamide, troglitazone, and bosentan. BSEP is the main transporter in hepatocytes responsible for exporting bile salts across the apical membrane into bile canaliculi. Therefore, inhibiting BSEP should cause cytotoxic bile salts to accumulate in hepatocytes, leading to liver injury and impaired bile flow. Indeed, there is a strong association between BSEP inhibition and cholestasis in humans, and BSEP inhibitors are shown to induce cholestasis in vitro. However, hepatocytes have safety mechanisms that can compensate for impaired canalicular bile efflux. In response to cholestasis, MRP3 and MRP4 on the basolateral membrane are upregulated to allow efflux of accumulated bile salts into portal blood. Similarly, MRP2 can accommodate additional bile flow across the apical membrane in cholestatic conditions. These compensatory mechanisms explain why some BSEP inhibitors do not cause cholestasis.
Two polypeptides. A large subunit of 104 amino acids (sequence TMWGTKWCGSGNEATDISELGYWSNLDSCCRTHDHCDNIPSGQTKYGLTNEGKYTMMNCKCETAFEQCLRNVTGGMEGPAAGFVRKTYFDLYGNGCYNVQCPSQ) and a smaller one of 27 amino acids (sequence SEECPDGVATYTGEAGYGAWAINKLNG). Subunits are linked by a disulfide bond. Phospholipase A2 (PLA2) activity on the large subunit. The molecular weight of the toxin is 15 kDa. Like IpTxa, IpTxi acts on RyR. When an action potential reaches the muscle, RyR channels open and Ca2+ becomes available in the cell to induce contraction. The presence of Ca2+ induces the large subunit of IpTxi to hydrolyze the Sn2 fatty acyl bond from the membrane of the sarcoplasmatic reticulum. This process is executed by PLA2 activity. The freed fatty acids bind to the RyR itself or to a closely associated protein linked to gating. Binding of the RyR induces blocking of the channel. When the concentration of free fatty acids is low there will be an incomplete block of RyR; higher concentrations will give a complete block. Because IpTxi also works on the RyR channels of the heart muscles, it could potentially be used as a drug against arrhythmia. This has not yet been proven, and must be studied in vivo first.
=== Regulation === Paralogs are often regulated differently, e.g. by having different tissue-specific expression patterns (see Hox genes). However, they can also be regulated differently on the protein level. For instance, Bacillus subtilis encodes two paralogues of glutamate dehydrogenase: GudB is constitutively transcribed whereas RocG is tightly regulated. In their active, oligomeric states, both enzymes show similar enzymatic rates. However, swaps of enzymes and promoters cause severe fitness losses, thus indicating promoter–enzyme coevolution. Characterization of the proteins shows that, compared to RocG, GudB's enzymatic activity is highly dependent on glutamate and pH.
Sources: en.wikipedia.org
The mouth is the first part of the upper gastrointestinal tract and is equipped with several structures that begin the first processes of digestion. These include salivary glands, teeth and the tongue. The mouth consists of two regions; the vestibule and the oral cavity proper. The vestibule is the area between the teeth, lips and cheeks, and the rest is the oral cavity proper. Most of the oral cavity is lined with oral mucosa, a mucous membrane that produces a lubricating mucus, of which only a small amount is needed. Mucous membranes vary in structure in the different regions of the body but they all produce a lubricating mucus, which is either secreted by surface cells or more usually by underlying glands. The mucous membrane in the mouth continues as the thin mucosa which lines the bases of the teeth. The main component of mucus is a glycoprotein called mucin and the type secreted varies according to the region involved. Mucin is viscous, clear, and clinging. Underlying the mucous membrane in the mouth is a thin layer of smooth muscle tissue and the loose connection to the membrane gives it its great elasticity. It covers the cheeks, inner surfaces of the lips, and floor of the mouth, and the mucin produced is highly protective against tooth decay. The roof of the mouth is termed the palate and it separates the oral cavity from the nasal cavity.
All work in Berlin ceased by July. Hahn and his family moved to the house of a textile manufacturer there. Life became precarious for those married to Jewish women. One was Philipp Hoernes, a chemist working for Auergesellschaft, the firm that mined the uranium ore used by the project. After the firm let him go in 1944, Hoernes faced being conscripted for forced labour. At the age of 60, it was doubtful that he would survive. Hahn and Nikolaus Riehl arranged for Hoernes to work at the KWIC, claiming that his work was essential to the uranium project and that uranium was highly toxic, making it hard to find people to work with it. Hahn was aware that uranium ore was fairly safe in the laboratory and could be mined safely using the correct equipment and procedures, but the 2,000 female slave labourers from the Sachsenhausen concentration camp who mined it in Oranienburg suffered agonising deaths because their Nazi slavedrivers wilfully neglected their safety. Another physicist with a Jewish wife was Heinrich Rausch von Traubenberg. Hahn certified that his work was important to the war effort, and that his wife Maria, who had a doctorate in physics, was required as his assistant. After he died on 19 September 1944, Maria faced being sent to a concentration camp. Hahn mounted a lobbying campaign to get her released, but to no avail, and she was sent to the Theresienstadt Ghetto in January 1945. She survived the war, and was reunited with her daughters in England.
=== Cell migration === Cell migration is essential for the formation of granulation tissue. The early stage of granulation tissue is dominated by a HA-rich extracellular matrix, which is regarded as a conducive environment for the migration of cells into this temporary wound matrix. HA provides an open hydrated matrix that facilitates cell migration, whereas, in the latter scenario, directed migration and control of related cell mechanisms are mediated via the specific cell interaction between HA and cell surface HA receptors. It forms links with several protein kinases associated with cell locomotion, for example, extracellular signal-regulated kinase, focal adhesion kinase, and other non-receptor tyrosine kinases. During fetal development, the migration path through which neural crest cells migrate is rich in HA. HA is closely associated with the cell migration process in granulation tissue matrix, and studies show that cell movement can be inhibited, at least partially, by HA degradation or blocking HA receptor occupancy. By providing the dynamic force to the cell, HA synthesis has also been shown to associate with cell migration. Basically, HA is synthesized at the plasma membrane and released directly into the extracellular environment. This may contribute to the hydrated microenvironment at sites of synthesis, and is essential for cell migration by facilitating cell detachment.
== Therapeutic use == U7-CNTX-Pn1a can potentially be used as an analgesic and anti-nociception in a clinical setting or as a pharmacological tool to study the TRPV1 channel family. In various pain models it exhibited antinociceptive effects to different extents. In the incision model in postoperative pain, it reduced mechanical hyperalgesia in animal models (30–300 fmol/site, i.t.). Additionally, consistent antinociceptive effects were measured after daily use of U7-CNTX-Pn1a (30 fmol/site, i.t.), and, in the partial sciatic nerve ligation model of neuropathic pain, a short-lasting reduction of mechanical hyperalgesia was observed (1h). The most promising and novel therapeutic use of U7-CNTX-Pn1a is in cancer-related pain-models, which was applied in mice. 30 fmol/site, i.t. reduced mechanical hyperalgesia in these mice models also for mice that developed morphine tolerance.
Sources: en.wikipedia.org
Liquid chromatography coupled with tandem mass spectrometry is widely used because it can separate NMN from related nucleotides and quantify low concentrations. Stable isotope-labeled internal standards help correct for matrix effects and recovery losses. Ultraviolet detection alone is less specific for complex biological matrices.
Research-grade NMN powder is commonly stored frozen, desiccated, and protected from light. Sealed containers at minus twenty degrees Celsius or below are typical. Allow containers to reach room temperature before opening to reduce condensation.
Purity is one quality attribute and does not by itself establish identity, safety, or absence of contaminants. A complete assessment includes structural confirmation, residual solvent testing, and microbial limits when relevant. Different analytical methods can yield different purity values.
NMN stands for nicotinamide mononucleotide. It is a nucleotide composed of nicotinamide, ribose, and phosphate. In cells, it is an intermediate in NAD+ biosynthesis.